PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma76g00140.1
Common NameZOSMA_76G00140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 177aa    MW: 20416.5 Da    PI: 10.5937
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma76g00140.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.36.4e-31958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien +nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+
  Zosma76g00140.1  9 KRIENPTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSNRGRLYEYA 58
                     79***********************************************8 PP

2K-box904.4e-30781745100
            K-box   5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      sg+  +++a+a+++ +e++kL++++ ++q++ ++llG+ L+++ ++eL+qLe++L+++++kiRsk+n+ll+++i  +qk+e elq +n++Lr+k
  Zosma76g00140.1  78 SGSGsVSQANAQYYLKESSKLRQQMIEMQNTTKKLLGDTLTTMPMRELKQLERRLDQAVQKIRSKRNQLLVAEIGSMQKREMELQTDNTYLRAK 171
                      4444599*************************************************************************************** PP

            K-box  98 lee 100
                      ++e
  Zosma76g00140.1 172 IAE 174
                      986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.726161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-33275IPR002100Transcription factor, MADS-box
CDDcd002651.60E-42276No hitNo description
PRINTSPR004046.1E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-333859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-2185172IPR002487Transcription factor, K-box
PROSITE profilePS5129712.54288176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGRGKIEIKR IENPTNRQVT FCKRRNGLLK KAYELSVLCD AEVALVIFSN RGRLYEYANH  60
SVRGSIDRYK KWTASHNSGS GSVSQANAQY YLKESSKLRQ QMIEMQNTTK KLLGDTLTTM  120
PMRELKQLER RLDQAVQKIR SKRNQLLVAE IGSMQKREME LQTDNTYLRA KIAEKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-23182182Myocyte-specific enhancer factor 2B
1tqe_R4e-23182182Myocyte-specific enhancer factor 2B
1tqe_Q4e-23182182Myocyte-specific enhancer factor 2B
1tqe_P4e-23182182Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010272685.12e-85PREDICTED: floral homeotic protein AGAMOUS-like
SwissprotQ015403e-84AG_BRANA; Floral homeotic protein AGAMOUS
TrEMBLA0A0K9NPB31e-128A0A0K9NPB3_Z
STRINGBra013364.1-P8e-82(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-77MIKC_MADS family protein